Anti ZNF165 pAb (ATL-HPA007247)

Atlas Antibodies

Catalog No.: ATL-HPA007247-25

Protein Description: zinc finger protein 165
Gene Name: ZNF165
Alternative Gene Name: CT53, ZSCAN7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029729: 32%, ENSRNOG00000052959: 31%
Entrez Gene ID: 7718
Uniprot ID: P49910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, ChIP
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AWVHEHYPESGEEAVTILEDLERGTDEAVLQVQAHEHGQEIFQKKVSPPGPALNVKLQPVETKAHFDSSEPQLLWDCDNESENSRSMPKLEIFEKIESQRIISGRISGYISEASGESQ
• Gene Sequence: AWVHEHYPESGEEAVTILEDLERGTDEAVLQVQAHEHGQEIFQKKVSPPGPALNVKLQPVETKAHFDSSEPQLLWDCDNESENSRSMPKLEIFEKIESQRIISGRISGYISEASGESQ
• Gene ID - Mouse: ENSMUSG00000029729
• Gene ID - Rat: ENSRNOG00000052959
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZNF165 pAb (ATL-HPA007247) – 1 Found

Gibbs, Zane A; Reza, Luis C; Cheng, Chun-Chun; Westcott, Jill M; McGlynn, Kathleen; Whitehurst, Angelique W. The testis protein ZNF165 is a SMAD3 cofactor that coordinates oncogenic TGFβ signaling in triple-negative breast cancer. Elife. 2020;9( 32515734)