Anti ZNF154 pAb (ATL-HPA076284)

Atlas Antibodies

SKU:
ATL-HPA076284-25
  • Immunohistochemical staining of human parathyroid gland shows strong nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line AF22 shows localization to nucleoplasm & nucleoli fibrillar center.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 154
Gene Name: ZNF154
Alternative Gene Name: pHZ-92
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030443: 36%, ENSRNOG00000034184: 36%
Entrez Gene ID: 7710
Uniprot ID: Q13106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAKLGFLHQQAAHTGEQSNSKSDGGAISHRGKTHYNCGEHTKAFSGKHTLVQQQRTLTTERCY
Gene Sequence LAKLGFLHQQAAHTGEQSNSKSDGGAISHRGKTHYNCGEHTKAFSGKHTLVQQQRTLTTERCY
Gene ID - Mouse ENSMUSG00000030443
Gene ID - Rat ENSRNOG00000034184
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF154 pAb (ATL-HPA076284)
Datasheet Anti ZNF154 pAb (ATL-HPA076284) Datasheet (External Link)
Vendor Page Anti ZNF154 pAb (ATL-HPA076284) at Atlas Antibodies

Documents & Links for Anti ZNF154 pAb (ATL-HPA076284)
Datasheet Anti ZNF154 pAb (ATL-HPA076284) Datasheet (External Link)
Vendor Page Anti ZNF154 pAb (ATL-HPA076284)