Anti ZNF136 pAb (ATL-HPA054120)

Atlas Antibodies

Catalog No.:
ATL-HPA054120-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 136
Gene Name: ZNF136
Alternative Gene Name: pHZ-20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074194: 52%, ENSRNOG00000033906: 52%
Entrez Gene ID: 7695
Uniprot ID: P52737
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ECGKAYSCRASFQRHMLTHAEDGPPYKCMWE
Gene Sequence ECGKAYSCRASFQRHMLTHAEDGPPYKCMWE
Gene ID - Mouse ENSMUSG00000074194
Gene ID - Rat ENSRNOG00000033906
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF136 pAb (ATL-HPA054120)
Datasheet Anti ZNF136 pAb (ATL-HPA054120) Datasheet (External Link)
Vendor Page Anti ZNF136 pAb (ATL-HPA054120) at Atlas Antibodies

Documents & Links for Anti ZNF136 pAb (ATL-HPA054120)
Datasheet Anti ZNF136 pAb (ATL-HPA054120) Datasheet (External Link)
Vendor Page Anti ZNF136 pAb (ATL-HPA054120)