Anti ZNF132 pAb (ATL-HPA008726)

Atlas Antibodies

Catalog No.: ATL-HPA008726-25

Protein Description: zinc finger protein 132
Gene Name: ZNF132
Alternative Gene Name: pHZ-12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031374: 38%, ENSRNOG00000051836: 39%
Entrez Gene ID: 7691
Uniprot ID: P52740
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EHQGTQSEEKPYTCGACGRDFWLNANLHQHQKEHSGGKPFRWYKDRDALMKSSKVHLSENPFTCREGGKVILGSCDLLQLQAVDSGQKPYSNLGQLPEVCTTQKLFECSNCGKAFLKSSTLPNHLRTHSE
• Gene Sequence: EHQGTQSEEKPYTCGACGRDFWLNANLHQHQKEHSGGKPFRWYKDRDALMKSSKVHLSENPFTCREGGKVILGSCDLLQLQAVDSGQKPYSNLGQLPEVCTTQKLFECSNCGKAFLKSSTLPNHLRTHSE
• Gene ID - Mouse: ENSMUSG00000031374
• Gene ID - Rat: ENSRNOG00000051836
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZNF132 pAb (ATL-HPA008726) – 1 Found

Abildgaard, Mette Opstrup; Borre, Michael; Mortensen, Martin Mørck; Ulhøi, Benedicte P; Tørring, Niels; Wild, Peter; Kristensen, Helle; Mansilla, Francisco; Ottosen, Peter D; Dyrskjøt, Lars; Ørntoft, Torben F; Sørensen, Karina Dalsgaard. Downregulation of zinc finger protein 132 in prostate cancer is associated with aberrant promoter hypermethylation and poor prognosis. International Journal Of Cancer. 2012;130(4):885-95.