Anti ZNF12 pAb (ATL-HPA063402)

Atlas Antibodies

Catalog No.:
ATL-HPA063402-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 12
Gene Name: ZNF12
Alternative Gene Name: GIOT-3, KOX3, ZNF325
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029587: 67%, ENSRNOG00000006958: 63%
Entrez Gene ID: 7559
Uniprot ID: P17014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EYIECQKAFQKDTVFVNHMEEKPYKWNGSEIAFLQMSDLTVHQTSHMEMKPY
Gene Sequence EYIECQKAFQKDTVFVNHMEEKPYKWNGSEIAFLQMSDLTVHQTSHMEMKPY
Gene ID - Mouse ENSMUSG00000029587
Gene ID - Rat ENSRNOG00000006958
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF12 pAb (ATL-HPA063402)
Datasheet Anti ZNF12 pAb (ATL-HPA063402) Datasheet (External Link)
Vendor Page Anti ZNF12 pAb (ATL-HPA063402) at Atlas Antibodies

Documents & Links for Anti ZNF12 pAb (ATL-HPA063402)
Datasheet Anti ZNF12 pAb (ATL-HPA063402) Datasheet (External Link)
Vendor Page Anti ZNF12 pAb (ATL-HPA063402)