Anti ZNF101 pAb (ATL-HPA055486)

Atlas Antibodies

Catalog No.: ATL-HPA055486-25

Protein Description: zinc finger protein 101
Gene Name: ZNF101
Alternative Gene Name: DKFZp570I0164, HZF12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095253: 48%, ENSRNOG00000032552: 45%
Entrez Gene ID: 94039
Uniprot ID: Q8IZC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGIQWKDQDIENLYQNLGIKLRSLVERLCGRK
• Gene Sequence: VGIQWKDQDIENLYQNLGIKLRSLVERLCGRK
• Gene ID - Mouse: ENSMUSG00000095253
• Gene ID - Rat: ENSRNOG00000032552
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.