Anti ZNF101 pAb (ATL-HPA055486)

Atlas Antibodies

Catalog No.:
ATL-HPA055486-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 101
Gene Name: ZNF101
Alternative Gene Name: DKFZp570I0164, HZF12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095253: 48%, ENSRNOG00000032552: 45%
Entrez Gene ID: 94039
Uniprot ID: Q8IZC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGIQWKDQDIENLYQNLGIKLRSLVERLCGRK
Gene Sequence VGIQWKDQDIENLYQNLGIKLRSLVERLCGRK
Gene ID - Mouse ENSMUSG00000095253
Gene ID - Rat ENSRNOG00000032552
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF101 pAb (ATL-HPA055486)
Datasheet Anti ZNF101 pAb (ATL-HPA055486) Datasheet (External Link)
Vendor Page Anti ZNF101 pAb (ATL-HPA055486) at Atlas Antibodies

Documents & Links for Anti ZNF101 pAb (ATL-HPA055486)
Datasheet Anti ZNF101 pAb (ATL-HPA055486) Datasheet (External Link)
Vendor Page Anti ZNF101 pAb (ATL-HPA055486)