Anti ZMYM6 pAb (ATL-HPA071865)

Atlas Antibodies

SKU: ATL-HPA071865-25

• 

Protein Description: zinc finger, MYM-type 6
Gene Name: ZMYM6
Alternative Gene Name: Buster2, MYM, ZBED7, ZNF198L4, ZNF258
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042408: 80%, ENSRNOG00000013865: 82%
Entrez Gene ID: 9204
Uniprot ID: O95789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGFIICPGSKESSPRPQCVICGEILSSENMKPANLSHHLKTKHSELENKPVDFFEQKSLEMECQNSSLKKCLLVEKSLVKASYLIAFQTAAS
• Gene Sequence: VGFIICPGSKESSPRPQCVICGEILSSENMKPANLSHHLKTKHSELENKPVDFFEQKSLEMECQNSSLKKCLLVEKSLVKASYLIAFQTAAS
• Gene ID - Mouse: ENSMUSG00000042408
• Gene ID - Rat: ENSRNOG00000013865
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.