Anti ZMYM1 pAb (ATL-HPA064019)

Atlas Antibodies

SKU:
ATL-HPA064019-25
  • Immunofluorescent staining of human cell line SiHa shows localization to microtubule organizing center.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger, MYM-type 1
Gene Name: ZMYM1
Alternative Gene Name: FLJ23151, MYM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043872: 67%, ENSRNOG00000013855: 64%
Entrez Gene ID: 79830
Uniprot ID: Q5SVZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHL
Gene Sequence NSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHL
Gene ID - Mouse ENSMUSG00000043872
Gene ID - Rat ENSRNOG00000013855
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZMYM1 pAb (ATL-HPA064019)
Datasheet Anti ZMYM1 pAb (ATL-HPA064019) Datasheet (External Link)
Vendor Page Anti ZMYM1 pAb (ATL-HPA064019) at Atlas Antibodies

Documents & Links for Anti ZMYM1 pAb (ATL-HPA064019)
Datasheet Anti ZMYM1 pAb (ATL-HPA064019) Datasheet (External Link)
Vendor Page Anti ZMYM1 pAb (ATL-HPA064019)