Anti ZMAT5 pAb (ATL-HPA004858 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004858-100

Protein Description: zinc finger, matrin-type 5
Gene Name: ZMAT5
Alternative Gene Name: SNRNP20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009076: 94%, ENSRNOG00000007849: 93%
Entrez Gene ID: 55954
Uniprot ID: Q9UDW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPS
• Gene Sequence: RKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPS
• Gene ID - Mouse: ENSMUSG00000009076
• Gene ID - Rat: ENSRNOG00000007849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.