Anti ZMAT4 pAb (ATL-HPA056671)

Atlas Antibodies

Catalog No.:
ATL-HPA056671-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger matrin-type 4
Gene Name: ZMAT4
Alternative Gene Name: FLJ13842
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037492: 99%, ENSRNOG00000042690: 99%
Entrez Gene ID: 79698
Uniprot ID: Q9H898
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCN
Gene Sequence MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCN
Gene ID - Mouse ENSMUSG00000037492
Gene ID - Rat ENSRNOG00000042690
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZMAT4 pAb (ATL-HPA056671)
Datasheet Anti ZMAT4 pAb (ATL-HPA056671) Datasheet (External Link)
Vendor Page Anti ZMAT4 pAb (ATL-HPA056671) at Atlas Antibodies

Documents & Links for Anti ZMAT4 pAb (ATL-HPA056671)
Datasheet Anti ZMAT4 pAb (ATL-HPA056671) Datasheet (External Link)
Vendor Page Anti ZMAT4 pAb (ATL-HPA056671)