Anti ZMAT3 pAb (ATL-HPA054356)

Atlas Antibodies

Catalog No.:
ATL-HPA054356-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger, matrin-type 3
Gene Name: ZMAT3
Alternative Gene Name: FLJ12296, MGC10613, PAG608, WIG-1, WIG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027663: 96%, ENSRNOG00000010119: 96%
Entrez Gene ID: 64393
Uniprot ID: Q9HA38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV
Gene Sequence GPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV
Gene ID - Mouse ENSMUSG00000027663
Gene ID - Rat ENSRNOG00000010119
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZMAT3 pAb (ATL-HPA054356)
Datasheet Anti ZMAT3 pAb (ATL-HPA054356) Datasheet (External Link)
Vendor Page Anti ZMAT3 pAb (ATL-HPA054356) at Atlas Antibodies

Documents & Links for Anti ZMAT3 pAb (ATL-HPA054356)
Datasheet Anti ZMAT3 pAb (ATL-HPA054356) Datasheet (External Link)
Vendor Page Anti ZMAT3 pAb (ATL-HPA054356)