Anti ZKSCAN7 pAb (ATL-HPA071850)

Atlas Antibodies

Catalog No.:
ATL-HPA071850-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger with KRAB and SCAN domains 7
Gene Name: ZKSCAN7
Alternative Gene Name: FLJ12738, ZNF167, ZNF448, ZNF64, ZSCAN39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063488: 49%, ENSRNOG00000004104: 56%
Entrez Gene ID: 55888
Uniprot ID: Q9P0L1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MMESSELTPKQEIFKGSESSNSTSGGLFGVVPGGTETGDVCEDTFKELEGQPSNEEGSRLESDFLEIIDEDKK
Gene Sequence MMESSELTPKQEIFKGSESSNSTSGGLFGVVPGGTETGDVCEDTFKELEGQPSNEEGSRLESDFLEIIDEDKK
Gene ID - Mouse ENSMUSG00000063488
Gene ID - Rat ENSRNOG00000004104
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZKSCAN7 pAb (ATL-HPA071850)
Datasheet Anti ZKSCAN7 pAb (ATL-HPA071850) Datasheet (External Link)
Vendor Page Anti ZKSCAN7 pAb (ATL-HPA071850) at Atlas Antibodies

Documents & Links for Anti ZKSCAN7 pAb (ATL-HPA071850)
Datasheet Anti ZKSCAN7 pAb (ATL-HPA071850) Datasheet (External Link)
Vendor Page Anti ZKSCAN7 pAb (ATL-HPA071850)