Anti ZKSCAN3 pAb (ATL-HPA060116)

Atlas Antibodies

Catalog No.:
ATL-HPA060116-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger with KRAB and SCAN domains 3
Gene Name: ZKSCAN3
Alternative Gene Name: ZF47, Zfp47, ZNF306, ZNF309, ZSCAN35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021327: 48%, ENSRNOG00000055000: 45%
Entrez Gene ID: 80317
Uniprot ID: Q9BRR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGS
Gene Sequence AQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGS
Gene ID - Mouse ENSMUSG00000021327
Gene ID - Rat ENSRNOG00000055000
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZKSCAN3 pAb (ATL-HPA060116)
Datasheet Anti ZKSCAN3 pAb (ATL-HPA060116) Datasheet (External Link)
Vendor Page Anti ZKSCAN3 pAb (ATL-HPA060116) at Atlas Antibodies

Documents & Links for Anti ZKSCAN3 pAb (ATL-HPA060116)
Datasheet Anti ZKSCAN3 pAb (ATL-HPA060116) Datasheet (External Link)
Vendor Page Anti ZKSCAN3 pAb (ATL-HPA060116)