Anti ZKSCAN3 pAb (ATL-HPA060116)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060116-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZKSCAN3
Alternative Gene Name: ZF47, Zfp47, ZNF306, ZNF309, ZSCAN35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021327: 48%, ENSRNOG00000055000: 45%
Entrez Gene ID: 80317
Uniprot ID: Q9BRR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGS |
Gene Sequence | AQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGS |
Gene ID - Mouse | ENSMUSG00000021327 |
Gene ID - Rat | ENSRNOG00000055000 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZKSCAN3 pAb (ATL-HPA060116) | |
Datasheet | Anti ZKSCAN3 pAb (ATL-HPA060116) Datasheet (External Link) |
Vendor Page | Anti ZKSCAN3 pAb (ATL-HPA060116) at Atlas Antibodies |
Documents & Links for Anti ZKSCAN3 pAb (ATL-HPA060116) | |
Datasheet | Anti ZKSCAN3 pAb (ATL-HPA060116) Datasheet (External Link) |
Vendor Page | Anti ZKSCAN3 pAb (ATL-HPA060116) |