Anti ZKSCAN2 pAb (ATL-HPA049141)

Atlas Antibodies

SKU:
ATL-HPA049141-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger with KRAB and SCAN domains 2
Gene Name: ZKSCAN2
Alternative Gene Name: FLJ23199, ZNF694, ZSCAN34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030757: 73%, ENSRNOG00000024245: 69%
Entrez Gene ID: 342357
Uniprot ID: Q63HK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVHLEKETGRLRQQVSSPVHREKHSPLGAAWEVADFQPEQVETQPRAVSREEPGSLHSGHQEQLNRKRERR
Gene Sequence VVHLEKETGRLRQQVSSPVHREKHSPLGAAWEVADFQPEQVETQPRAVSREEPGSLHSGHQEQLNRKRERR
Gene ID - Mouse ENSMUSG00000030757
Gene ID - Rat ENSRNOG00000024245
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZKSCAN2 pAb (ATL-HPA049141)
Datasheet Anti ZKSCAN2 pAb (ATL-HPA049141) Datasheet (External Link)
Vendor Page Anti ZKSCAN2 pAb (ATL-HPA049141) at Atlas Antibodies

Documents & Links for Anti ZKSCAN2 pAb (ATL-HPA049141)
Datasheet Anti ZKSCAN2 pAb (ATL-HPA049141) Datasheet (External Link)
Vendor Page Anti ZKSCAN2 pAb (ATL-HPA049141)