Anti ZHX1 pAb (ATL-HPA055357)

Atlas Antibodies

Catalog No.:
ATL-HPA055357-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc fingers and homeoboxes 1
Gene Name: ZHX1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022361: 84%, ENSRNOG00000006412: 84%
Entrez Gene ID: 11244
Uniprot ID: Q9UKY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEEKMEIDESNAGSSKEEAGETSPADESGAPKSGSTGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESG
Gene Sequence KEEKMEIDESNAGSSKEEAGETSPADESGAPKSGSTGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESG
Gene ID - Mouse ENSMUSG00000022361
Gene ID - Rat ENSRNOG00000006412
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZHX1 pAb (ATL-HPA055357)
Datasheet Anti ZHX1 pAb (ATL-HPA055357) Datasheet (External Link)
Vendor Page Anti ZHX1 pAb (ATL-HPA055357) at Atlas Antibodies

Documents & Links for Anti ZHX1 pAb (ATL-HPA055357)
Datasheet Anti ZHX1 pAb (ATL-HPA055357) Datasheet (External Link)
Vendor Page Anti ZHX1 pAb (ATL-HPA055357)