Anti ZGPAT pAb (ATL-HPA056705)

Atlas Antibodies

SKU:
ATL-HPA056705-25
  • Immunofluorescent staining of human cell line CACO-2 shows localization to nucleus & plasma membrane.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger, CCCH-type with G patch domain
Gene Name: ZGPAT
Alternative Gene Name: dJ583P15.3, FLJ14972, GPATC6, GPATCH6, KIAA1847, MGC44880, ZC3H9, ZC3HDC9, ZIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027582: 78%, ENSRNOG00000014235: 78%
Entrez Gene ID: 84619
Uniprot ID: Q8N5A5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCVETLQKQTRVG
Gene Sequence ALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCVETLQKQTRVG
Gene ID - Mouse ENSMUSG00000027582
Gene ID - Rat ENSRNOG00000014235
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZGPAT pAb (ATL-HPA056705)
Datasheet Anti ZGPAT pAb (ATL-HPA056705) Datasheet (External Link)
Vendor Page Anti ZGPAT pAb (ATL-HPA056705) at Atlas Antibodies

Documents & Links for Anti ZGPAT pAb (ATL-HPA056705)
Datasheet Anti ZGPAT pAb (ATL-HPA056705) Datasheet (External Link)
Vendor Page Anti ZGPAT pAb (ATL-HPA056705)