Anti ZFYVE27 pAb (ATL-HPA069876)

Atlas Antibodies

Catalog No.:
ATL-HPA069876-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: zinc finger, FYVE domain containing 27
Gene Name: ZFYVE27
Alternative Gene Name: FLJ32919, SPG33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018820: 63%, ENSRNOG00000014903: 63%
Entrez Gene ID: 118813
Uniprot ID: Q5T4F4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEFFRVVSEYRASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTE
Gene Sequence VEFFRVVSEYRASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTE
Gene ID - Mouse ENSMUSG00000018820
Gene ID - Rat ENSRNOG00000014903
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZFYVE27 pAb (ATL-HPA069876)
Datasheet Anti ZFYVE27 pAb (ATL-HPA069876) Datasheet (External Link)
Vendor Page Anti ZFYVE27 pAb (ATL-HPA069876) at Atlas Antibodies

Documents & Links for Anti ZFYVE27 pAb (ATL-HPA069876)
Datasheet Anti ZFYVE27 pAb (ATL-HPA069876) Datasheet (External Link)
Vendor Page Anti ZFYVE27 pAb (ATL-HPA069876)