Anti ZFP90 pAb (ATL-HPA029017)

Atlas Antibodies

Catalog No.: ATL-HPA029017-25

Protein Description: ZFP90 zinc finger protein
Gene Name: ZFP90
Alternative Gene Name: KIAA1954, NK10, ZNF756
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031907: 56%, ENSRNOG00000020087: 59%
Entrez Gene ID: 146198
Uniprot ID: Q8TF47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEGEIQRPFYPDWKTRPEVKSSHLQQDVSEVSHCTHDLLHATLEDSWDVSSQLDRQQENWKRHLGS
• Gene Sequence: SEGEIQRPFYPDWKTRPEVKSSHLQQDVSEVSHCTHDLLHATLEDSWDVSSQLDRQQENWKRHLGS
• Gene ID - Mouse: ENSMUSG00000031907
• Gene ID - Rat: ENSRNOG00000020087
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.