Anti ZFP82 pAb (ATL-HPA051669)

Atlas Antibodies

Catalog No.:
ATL-HPA051669-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ZFP82 zinc finger protein
Gene Name: ZFP82
Alternative Gene Name: KIAA1948, MGC45380, ZNF545
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098022: 61%, ENSRNOG00000052023: 50%
Entrez Gene ID: 284406
Uniprot ID: Q8N141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NHGLKGLILKNDWESTGKIEGQERPQEGYFSSVKMPSEKVSSYQKRTSVTPHQRLH
Gene Sequence NHGLKGLILKNDWESTGKIEGQERPQEGYFSSVKMPSEKVSSYQKRTSVTPHQRLH
Gene ID - Mouse ENSMUSG00000098022
Gene ID - Rat ENSRNOG00000052023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZFP82 pAb (ATL-HPA051669)
Datasheet Anti ZFP82 pAb (ATL-HPA051669) Datasheet (External Link)
Vendor Page Anti ZFP82 pAb (ATL-HPA051669) at Atlas Antibodies

Documents & Links for Anti ZFP82 pAb (ATL-HPA051669)
Datasheet Anti ZFP82 pAb (ATL-HPA051669) Datasheet (External Link)
Vendor Page Anti ZFP82 pAb (ATL-HPA051669)