Anti ZFP69 pAb (ATL-HPA027808)

Atlas Antibodies

Catalog No.: ATL-HPA027808-25

Protein Description: ZFP69 zinc finger protein
Gene Name: ZFP69
Alternative Gene Name: FLJ16030, ZFP69A, ZKSCAN23A, ZNF642, ZSCAN54A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064141: 51%, ENSRNOG00000028662: 50%
Entrez Gene ID: 339559
Uniprot ID: Q49AA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEPWMAEKEGPGDPSSDLKSKIETIESTAKSTISQERLYHGIMMESFMRDDIIYSTLRKVSTYDDVLERHQETC
• Gene Sequence: EEPWMAEKEGPGDPSSDLKSKIETIESTAKSTISQERLYHGIMMESFMRDDIIYSTLRKVSTYDDVLERHQETC
• Gene ID - Mouse: ENSMUSG00000064141
• Gene ID - Rat: ENSRNOG00000028662
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.