Anti ZFP62 pAb (ATL-HPA048629)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048629-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZFP62
Alternative Gene Name: FLJ34231, ZET, ZNF755
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046311: 64%, ENSRNOG00000051756: 69%
Entrez Gene ID: 643836
Uniprot ID: Q8NB50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RTHTGEESLNVIYVGSYSGTSQKRTYEGGNALDGGRMRMPL |
Gene Sequence | RTHTGEESLNVIYVGSYSGTSQKRTYEGGNALDGGRMRMPL |
Gene ID - Mouse | ENSMUSG00000046311 |
Gene ID - Rat | ENSRNOG00000051756 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZFP62 pAb (ATL-HPA048629) | |
Datasheet | Anti ZFP62 pAb (ATL-HPA048629) Datasheet (External Link) |
Vendor Page | Anti ZFP62 pAb (ATL-HPA048629) at Atlas Antibodies |
Documents & Links for Anti ZFP62 pAb (ATL-HPA048629) | |
Datasheet | Anti ZFP62 pAb (ATL-HPA048629) Datasheet (External Link) |
Vendor Page | Anti ZFP62 pAb (ATL-HPA048629) |