Anti ZFP62 pAb (ATL-HPA048629)

Atlas Antibodies

Catalog No.:
ATL-HPA048629-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ZFP62 zinc finger protein
Gene Name: ZFP62
Alternative Gene Name: FLJ34231, ZET, ZNF755
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046311: 64%, ENSRNOG00000051756: 69%
Entrez Gene ID: 643836
Uniprot ID: Q8NB50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTHTGEESLNVIYVGSYSGTSQKRTYEGGNALDGGRMRMPL
Gene Sequence RTHTGEESLNVIYVGSYSGTSQKRTYEGGNALDGGRMRMPL
Gene ID - Mouse ENSMUSG00000046311
Gene ID - Rat ENSRNOG00000051756
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZFP62 pAb (ATL-HPA048629)
Datasheet Anti ZFP62 pAb (ATL-HPA048629) Datasheet (External Link)
Vendor Page Anti ZFP62 pAb (ATL-HPA048629) at Atlas Antibodies

Documents & Links for Anti ZFP62 pAb (ATL-HPA048629)
Datasheet Anti ZFP62 pAb (ATL-HPA048629) Datasheet (External Link)
Vendor Page Anti ZFP62 pAb (ATL-HPA048629)