Anti ZFP62 pAb (ATL-HPA048629)

Atlas Antibodies

Catalog No.: ATL-HPA048629-25

Protein Description: ZFP62 zinc finger protein
Gene Name: ZFP62
Alternative Gene Name: FLJ34231, ZET, ZNF755
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046311: 64%, ENSRNOG00000051756: 69%
Entrez Gene ID: 643836
Uniprot ID: Q8NB50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTHTGEESLNVIYVGSYSGTSQKRTYEGGNALDGGRMRMPL
• Gene Sequence: RTHTGEESLNVIYVGSYSGTSQKRTYEGGNALDGGRMRMPL
• Gene ID - Mouse: ENSMUSG00000046311
• Gene ID - Rat: ENSRNOG00000051756
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.