Anti ZFP41 pAb (ATL-HPA056268)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056268-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZFP41
Alternative Gene Name: FLJ00028, FLJ38705, ZNF753
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047003: 65%, ENSRNOG00000007489: 65%
Entrez Gene ID: 286128
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEKPAGRKKKTPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHVFDAFDASFKDDFEGVPVFIP |
Gene Sequence | MEKPAGRKKKTPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHVFDAFDASFKDDFEGVPVFIP |
Gene ID - Mouse | ENSMUSG00000047003 |
Gene ID - Rat | ENSRNOG00000007489 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZFP41 pAb (ATL-HPA056268) | |
Datasheet | Anti ZFP41 pAb (ATL-HPA056268) Datasheet (External Link) |
Vendor Page | Anti ZFP41 pAb (ATL-HPA056268) at Atlas Antibodies |
Documents & Links for Anti ZFP41 pAb (ATL-HPA056268) | |
Datasheet | Anti ZFP41 pAb (ATL-HPA056268) Datasheet (External Link) |
Vendor Page | Anti ZFP41 pAb (ATL-HPA056268) |