Anti ZFP3 pAb (ATL-HPA057290)

Atlas Antibodies

Catalog No.:
ATL-HPA057290-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ZFP3 zinc finger protein
Gene Name: ZFP3
Alternative Gene Name: FLJ30726, ZNF752
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043602: 48%, ENSRNOG00000005009: 53%
Entrez Gene ID: 124961
Uniprot ID: Q96NJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLMIFKKSPSSEKDRENNESERGCSPSPNLVTHQGDTTEGVSAFATSGQNFLEILESNKTQRSSVGE
Gene Sequence GLMIFKKSPSSEKDRENNESERGCSPSPNLVTHQGDTTEGVSAFATSGQNFLEILESNKTQRSSVGE
Gene ID - Mouse ENSMUSG00000043602
Gene ID - Rat ENSRNOG00000005009
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZFP3 pAb (ATL-HPA057290)
Datasheet Anti ZFP3 pAb (ATL-HPA057290) Datasheet (External Link)
Vendor Page Anti ZFP3 pAb (ATL-HPA057290) at Atlas Antibodies

Documents & Links for Anti ZFP3 pAb (ATL-HPA057290)
Datasheet Anti ZFP3 pAb (ATL-HPA057290) Datasheet (External Link)
Vendor Page Anti ZFP3 pAb (ATL-HPA057290)