Anti ZFP3 pAb (ATL-HPA053085)

Atlas Antibodies

Catalog No.: ATL-HPA053085-25

Protein Description: ZFP3 zinc finger protein
Gene Name: ZFP3
Alternative Gene Name: FLJ30726, ZNF752
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043602: 61%, ENSRNOG00000005009: 68%
Entrez Gene ID: 124961
Uniprot ID: Q96NJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIEQMSPQER
• Gene Sequence: GTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIEQMSPQER
• Gene ID - Mouse: ENSMUSG00000043602
• Gene ID - Rat: ENSRNOG00000005009
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.