Anti ZFP3 pAb (ATL-HPA053085)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053085-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZFP3
Alternative Gene Name: FLJ30726, ZNF752
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043602: 61%, ENSRNOG00000005009: 68%
Entrez Gene ID: 124961
Uniprot ID: Q96NJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIEQMSPQER |
Gene Sequence | GTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIEQMSPQER |
Gene ID - Mouse | ENSMUSG00000043602 |
Gene ID - Rat | ENSRNOG00000005009 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZFP3 pAb (ATL-HPA053085) | |
Datasheet | Anti ZFP3 pAb (ATL-HPA053085) Datasheet (External Link) |
Vendor Page | Anti ZFP3 pAb (ATL-HPA053085) at Atlas Antibodies |
Documents & Links for Anti ZFP3 pAb (ATL-HPA053085) | |
Datasheet | Anti ZFP3 pAb (ATL-HPA053085) Datasheet (External Link) |
Vendor Page | Anti ZFP3 pAb (ATL-HPA053085) |