Anti ZFP1 pAb (ATL-HPA062910)

Atlas Antibodies

Catalog No.:
ATL-HPA062910-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ZFP1 zinc finger protein
Gene Name: ZFP1
Alternative Gene Name: FLJ34243, ZNF475
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055835: 67%, ENSRNOG00000019059: 64%
Entrez Gene ID: 162239
Uniprot ID: Q6P2D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAIFKHQKIKNLVQPFICTYCDK
Gene Sequence NRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAIFKHQKIKNLVQPFICTYCDK
Gene ID - Mouse ENSMUSG00000055835
Gene ID - Rat ENSRNOG00000019059
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZFP1 pAb (ATL-HPA062910)
Datasheet Anti ZFP1 pAb (ATL-HPA062910) Datasheet (External Link)
Vendor Page Anti ZFP1 pAb (ATL-HPA062910) at Atlas Antibodies

Documents & Links for Anti ZFP1 pAb (ATL-HPA062910)
Datasheet Anti ZFP1 pAb (ATL-HPA062910) Datasheet (External Link)
Vendor Page Anti ZFP1 pAb (ATL-HPA062910)