Anti ZFAND3 pAb (ATL-HPA016755)

Atlas Antibodies

Catalog No.: ATL-HPA016755-25

Protein Description: zinc finger, AN1-type domain 3
Gene Name: ZFAND3
Alternative Gene Name: FLJ13222, TEX27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044477: 98%, ENSRNOG00000059659: 94%
Entrez Gene ID: 60685
Uniprot ID: Q9H8U3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLFSEETTSDNNNTSITTPTLSP
• Gene Sequence: MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLFSEETTSDNNNTSITTPTLSP
• Gene ID - Mouse: ENSMUSG00000044477
• Gene ID - Rat: ENSRNOG00000059659
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZFAND3 pAb (ATL-HPA016755) – 1 Found

Schuster, Anne; Klein, Eliane; Neirinckx, Virginie; Knudsen, Arnon Møldrup; Fabian, Carina; Hau, Ann-Christin; Dieterle, Monika; Oudin, Anais; Nazarov, Petr V; Golebiewska, Anna; Muller, Arnaud; Perez-Hernandez, Daniel; Rodius, Sophie; Dittmar, Gunnar; Bjerkvig, Rolf; Herold-Mende, Christel; Klink, Barbara; Kristensen, Bjarne Winther; Niclou, Simone P. AN1-type zinc finger protein 3 (ZFAND3) is a transcriptional regulator that drives Glioblastoma invasion. Nature Communications. 2020;11(1):6366.