Anti ZDHHC7 pAb (ATL-HPA059054)

Atlas Antibodies

Catalog No.: ATL-HPA059054-25

Protein Description: zinc finger, DHHC-type containing 7
Gene Name: ZDHHC7
Alternative Gene Name: FLJ10792, FLJ20279, SERZ-B, SERZ1, ZNF370
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031823: 91%, ENSRNOG00000017342: 92%
Entrez Gene ID: 55625
Uniprot ID: Q9NXF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKSENPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFS
• Gene Sequence: LKSENPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFS
• Gene ID - Mouse: ENSMUSG00000031823
• Gene ID - Rat: ENSRNOG00000017342
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.