Anti ZDHHC7 pAb (ATL-HPA059054)

Atlas Antibodies

Catalog No.:
ATL-HPA059054-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger, DHHC-type containing 7
Gene Name: ZDHHC7
Alternative Gene Name: FLJ10792, FLJ20279, SERZ-B, SERZ1, ZNF370
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031823: 91%, ENSRNOG00000017342: 92%
Entrez Gene ID: 55625
Uniprot ID: Q9NXF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKSENPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFS
Gene Sequence LKSENPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFS
Gene ID - Mouse ENSMUSG00000031823
Gene ID - Rat ENSRNOG00000017342
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZDHHC7 pAb (ATL-HPA059054)
Datasheet Anti ZDHHC7 pAb (ATL-HPA059054) Datasheet (External Link)
Vendor Page Anti ZDHHC7 pAb (ATL-HPA059054) at Atlas Antibodies

Documents & Links for Anti ZDHHC7 pAb (ATL-HPA059054)
Datasheet Anti ZDHHC7 pAb (ATL-HPA059054) Datasheet (External Link)
Vendor Page Anti ZDHHC7 pAb (ATL-HPA059054)