Anti ZDHHC21 pAb (ATL-HPA065254)

Atlas Antibodies

Catalog No.:
ATL-HPA065254-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger, DHHC-type containing 21
Gene Name: ZDHHC21
Alternative Gene Name: DNZ1, HSPC097
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028403: 94%, ENSRNOG00000010484: 94%
Entrez Gene ID: 340481
Uniprot ID: Q8IVQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRM
Gene Sequence RASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRM
Gene ID - Mouse ENSMUSG00000028403
Gene ID - Rat ENSRNOG00000010484
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZDHHC21 pAb (ATL-HPA065254)
Datasheet Anti ZDHHC21 pAb (ATL-HPA065254) Datasheet (External Link)
Vendor Page Anti ZDHHC21 pAb (ATL-HPA065254) at Atlas Antibodies

Documents & Links for Anti ZDHHC21 pAb (ATL-HPA065254)
Datasheet Anti ZDHHC21 pAb (ATL-HPA065254) Datasheet (External Link)
Vendor Page Anti ZDHHC21 pAb (ATL-HPA065254)