Anti ZDHHC20 pAb (ATL-HPA014702)

Atlas Antibodies

Catalog No.: ATL-HPA014702-25

Protein Description: zinc finger, DHHC-type containing 20
Gene Name: ZDHHC20
Alternative Gene Name: FLJ25952
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021969: 89%, ENSRNOG00000011024: 93%
Entrez Gene ID: 253832
Uniprot ID: Q5W0Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIE
• Gene Sequence: SSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIE
• Gene ID - Mouse: ENSMUSG00000021969
• Gene ID - Rat: ENSRNOG00000011024
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZDHHC20 pAb (ATL-HPA014702) – 3 Found

Wang, Wei; Runkle, Kristin B; Terkowski, Samantha M; Ekaireb, Rachel I; Witze, Eric S. Protein Depalmitoylation Is Induced by Wnt5a and Promotes Polarized Cell Behavior. The Journal Of Biological Chemistry. 2015;290(25):15707-15716. 

Kharbanda, Akriti; Runkle, Kristin; Wang, Wei; Witze, Eric S. Induced sensitivity to EGFR inhibitors is mediated by palmitoylated cysteine 1025 of EGFR and requires oncogenic Kras. Biochemical And Biophysical Research Communications. 2017;493(1):213-219. 

Kharbanda, Akriti; Walter, David M; Gudiel, Andrea A; Schek, Nancy; Feldser, David M; Witze, Eric S. Blocking EGFR palmitoylation suppresses PI3K signaling and mutant KRAS lung tumorigenesis. Science Signaling. 2020;13(621)