Anti ZDHHC20 pAb (ATL-HPA014483)

Atlas Antibodies

Catalog No.: ATL-HPA014483-25

Protein Description: zinc finger, DHHC-type containing 20
Gene Name: ZDHHC20
Alternative Gene Name: FLJ25952
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021969: 94%, ENSRNOG00000011024: 93%
Entrez Gene ID: 253832
Uniprot ID: Q5W0Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCV
• Gene Sequence: SKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCV
• Gene ID - Mouse: ENSMUSG00000021969
• Gene ID - Rat: ENSRNOG00000011024
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZDHHC20 pAb (ATL-HPA014483) – 1 Found

Stypulkowski, Ewa; Asangani, Irfan A; Witze, Eric S. The depalmitoylase APT1 directs the asymmetric partitioning of Notch and Wnt signaling during cell division. Science Signaling. 2018;11(511)