Anti ZDHHC20 pAb (ATL-HPA014483)

Atlas Antibodies

Catalog No.:
ATL-HPA014483-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger, DHHC-type containing 20
Gene Name: ZDHHC20
Alternative Gene Name: FLJ25952
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021969: 94%, ENSRNOG00000011024: 93%
Entrez Gene ID: 253832
Uniprot ID: Q5W0Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCV
Gene Sequence SKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCV
Gene ID - Mouse ENSMUSG00000021969
Gene ID - Rat ENSRNOG00000011024
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZDHHC20 pAb (ATL-HPA014483)
Datasheet Anti ZDHHC20 pAb (ATL-HPA014483) Datasheet (External Link)
Vendor Page Anti ZDHHC20 pAb (ATL-HPA014483) at Atlas Antibodies

Documents & Links for Anti ZDHHC20 pAb (ATL-HPA014483)
Datasheet Anti ZDHHC20 pAb (ATL-HPA014483) Datasheet (External Link)
Vendor Page Anti ZDHHC20 pAb (ATL-HPA014483)
Citations for Anti ZDHHC20 pAb (ATL-HPA014483) – 1 Found
Stypulkowski, Ewa; Asangani, Irfan A; Witze, Eric S. The depalmitoylase APT1 directs the asymmetric partitioning of Notch and Wnt signaling during cell division. Science Signaling. 2018;11(511)  PubMed