Anti ZDHHC2 pAb (ATL-HPA023331)

Atlas Antibodies

Catalog No.: ATL-HPA023331-25

Protein Description: zinc finger, DHHC-type containing 2
Gene Name: ZDHHC2
Alternative Gene Name: ZNF372
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039470: 98%, ENSRNOG00000022686: 96%
Entrez Gene ID: 51201
Uniprot ID: Q9UIJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLI
• Gene Sequence: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLI
• Gene ID - Mouse: ENSMUSG00000039470
• Gene ID - Rat: ENSRNOG00000022686
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.