Anti ZDHHC14 pAb (ATL-HPA063754)

Atlas Antibodies

SKU:
ATL-HPA063754-25
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger, DHHC-type containing 14
Gene Name: ZDHHC14
Alternative Gene Name: FLJ20984, NEW1CP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034265: 98%, ENSRNOG00000029049: 100%
Entrez Gene ID: 79683
Uniprot ID: Q8IZN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTNCCVALCGPISPSLIDRRGYIQPDTPQPAAPSNGITMYGATQSQSDMCDQDQCIQSTKFV
Gene Sequence FTNCCVALCGPISPSLIDRRGYIQPDTPQPAAPSNGITMYGATQSQSDMCDQDQCIQSTKFV
Gene ID - Mouse ENSMUSG00000034265
Gene ID - Rat ENSRNOG00000029049
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZDHHC14 pAb (ATL-HPA063754)
Datasheet Anti ZDHHC14 pAb (ATL-HPA063754) Datasheet (External Link)
Vendor Page Anti ZDHHC14 pAb (ATL-HPA063754) at Atlas Antibodies

Documents & Links for Anti ZDHHC14 pAb (ATL-HPA063754)
Datasheet Anti ZDHHC14 pAb (ATL-HPA063754) Datasheet (External Link)
Vendor Page Anti ZDHHC14 pAb (ATL-HPA063754)