Anti ZDHHC12 pAb (ATL-HPA059339)

Atlas Antibodies

Catalog No.:
ATL-HPA059339-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger, DHHC-type containing 12
Gene Name: ZDHHC12
Alternative Gene Name: FLJ14524, ZNF400
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015335: 84%, ENSRNOG00000015791: 93%
Entrez Gene ID: 84885
Uniprot ID: Q96GR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRY
Gene Sequence MDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRY
Gene ID - Mouse ENSMUSG00000015335
Gene ID - Rat ENSRNOG00000015791
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZDHHC12 pAb (ATL-HPA059339)
Datasheet Anti ZDHHC12 pAb (ATL-HPA059339) Datasheet (External Link)
Vendor Page Anti ZDHHC12 pAb (ATL-HPA059339) at Atlas Antibodies

Documents & Links for Anti ZDHHC12 pAb (ATL-HPA059339)
Datasheet Anti ZDHHC12 pAb (ATL-HPA059339) Datasheet (External Link)
Vendor Page Anti ZDHHC12 pAb (ATL-HPA059339)
Citations for Anti ZDHHC12 pAb (ATL-HPA059339) – 1 Found
Yuan, Meng; Chen, Xiaobing; Sun, Yitang; Jiang, Li; Xia, Zhongni; Ye, Kaixiong; Jiang, Hong; Yang, Bo; Ying, Meidan; Cao, Ji; He, Qiaojun. ZDHHC12-mediated claudin-3 S-palmitoylation determines ovarian cancer progression. Acta Pharmaceutica Sinica. B. 2020;10(8):1426-1439.  PubMed