Anti ZDHHC11B pAb (ATL-HPA057886)

Atlas Antibodies

Catalog No.: ATL-HPA057886-25

Protein Description: zinc finger, DHHC-type containing 11B
Gene Name: ZDHHC11B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069189: 43%, ENSRNOG00000039743: 51%
Entrez Gene ID:
Uniprot ID: P0C7U3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDTRSGSQCSVTPEAIRNNEELVLPPRISRVNGWSLP
• Gene Sequence: MDTRSGSQCSVTPEAIRNNEELVLPPRISRVNGWSLP
• Gene ID - Mouse: ENSMUSG00000069189
• Gene ID - Rat: ENSRNOG00000039743
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZDHHC11B pAb (ATL-HPA057886) – 1 Found

Sato, Kuniaki; Komune, Noritaka; Hongo, Takahiro; Koike, Kensuke; Niida, Atsushi; Uchi, Ryutaro; Noda, Teppei; Kogo, Ryunosuke; Matsumoto, Nozomu; Yamamoto, Hidetaka; Masuda, Muneyuki; Oda, Yoshinao; Mimori, Koshi; Nakagawa, Takashi. Genetic landscape of external auditory canal squamous cell carcinoma. Cancer Science. 2020;111(8):3010-3019.