Anti ZDBF2 pAb (ATL-HPA050311)

Atlas Antibodies

Catalog No.:
ATL-HPA050311-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger, DBF-type containing 2
Gene Name: ZDBF2
Alternative Gene Name: FLJ45338, KIAA1571
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027520: 38%, ENSRNOG00000024114: 43%
Entrez Gene ID: 57683
Uniprot ID: Q9HCK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KISSDCDDILHLVTNQSQMIVKEISLQNARHISLVDQSYESSSSETNFDCDASPQSTSDYPQQSVTEVNLPKEVHIGLVDKN
Gene Sequence KISSDCDDILHLVTNQSQMIVKEISLQNARHISLVDQSYESSSSETNFDCDASPQSTSDYPQQSVTEVNLPKEVHIGLVDKN
Gene ID - Mouse ENSMUSG00000027520
Gene ID - Rat ENSRNOG00000024114
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZDBF2 pAb (ATL-HPA050311)
Datasheet Anti ZDBF2 pAb (ATL-HPA050311) Datasheet (External Link)
Vendor Page Anti ZDBF2 pAb (ATL-HPA050311) at Atlas Antibodies

Documents & Links for Anti ZDBF2 pAb (ATL-HPA050311)
Datasheet Anti ZDBF2 pAb (ATL-HPA050311) Datasheet (External Link)
Vendor Page Anti ZDBF2 pAb (ATL-HPA050311)