Anti ZCCHC7 pAb (ATL-HPA021088 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021088-25

Protein Description: zinc finger, CCHC domain containing 7
Gene Name: ZCCHC7
Alternative Gene Name: AIR1, FLJ22611
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035649: 77%, ENSRNOG00000013078: 72%
Entrez Gene ID: 84186
Uniprot ID: Q8N3Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MMFGGYETIEAYEDDLYRDESSSELSVDSEVEFQLYSQIHYAQDLDDVIREEEHEEKNSGNSESSSSKPNQKKLIVLSDSEVIQLSDGSEVITLSDEDSIYRCKGKNVRVQAQENAH
• Gene Sequence: MMFGGYETIEAYEDDLYRDESSSELSVDSEVEFQLYSQIHYAQDLDDVIREEEHEEKNSGNSESSSSKPNQKKLIVLSDSEVIQLSDGSEVITLSDEDSIYRCKGKNVRVQAQENAH
• Gene ID - Mouse: ENSMUSG00000035649
• Gene ID - Rat: ENSRNOG00000013078
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZCCHC7 pAb (ATL-HPA021088 w/enhanced validation) – 1 Found

Fasken, Milo B; Leung, Sara W; Banerjee, Ayan; Kodani, Maja O; Chavez, Ramiro; Bowman, Elizabeth A; Purohit, Meghan K; Rubinson, Max E; Rubinson, Emily H; Corbett, Anita H. Air1 zinc knuckles 4 and 5 and a conserved IWRXY motif are critical for the function and integrity of the Trf4/5-Air1/2-Mtr4 polyadenylation (TRAMP) RNA quality control complex. The Journal Of Biological Chemistry. 2011;286(43):37429-45.