Anti ZC3HC1 pAb (ATL-HPA024023 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA024023-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger, C3HC-type containing 1
Gene Name: ZC3HC1
Alternative Gene Name: NIPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039130: 86%, ENSRNOG00000010154: 86%
Entrez Gene ID: 51530
Uniprot ID: Q86WB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen IQVHVTACILSVCGWACSSSLESMQLSLITCSQCMRKVGLWGFQQIESSMTDLDASFGLTSSPIPGLEGRPERLPLVPESPRRMMTRSQD
Gene Sequence IQVHVTACILSVCGWACSSSLESMQLSLITCSQCMRKVGLWGFQQIESSMTDLDASFGLTSSPIPGLEGRPERLPLVPESPRRMMTRSQD
Gene ID - Mouse ENSMUSG00000039130
Gene ID - Rat ENSRNOG00000010154
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZC3HC1 pAb (ATL-HPA024023 w/enhanced validation)
Datasheet Anti ZC3HC1 pAb (ATL-HPA024023 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZC3HC1 pAb (ATL-HPA024023 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ZC3HC1 pAb (ATL-HPA024023 w/enhanced validation)
Datasheet Anti ZC3HC1 pAb (ATL-HPA024023 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZC3HC1 pAb (ATL-HPA024023 w/enhanced validation)
Citations for Anti ZC3HC1 pAb (ATL-HPA024023 w/enhanced validation) – 3 Found
Gengenbacher, Anina; Müller-Rudorf, Alina; Poggio, Teresa; Gräßel, Linda; Dumit, Veronica I; Kreutmair, Stefanie; Lippert, Lena J; Duyster, Justus; Illert, Anna L. Proteomic Phosphosite Analysis Identified Crucial NPM-ALK-Mediated NIPA Serine and Threonine Residues. International Journal Of Molecular Sciences. 2019;20(16)  PubMed
Kreutmair, Stefanie; Erlacher, Miriam; Andrieux, Geoffroy; Istvanffy, Rouzanna; Mueller-Rudorf, Alina; Zwick, Melissa; Rückert, Tamina; Pantic, Milena; Poggio, Teresa; Shoumariyeh, Khalid; Mueller, Tony A; Kawaguchi, Hiroyuki; Follo, Marie; Klingeberg, Cathrin; Wlodarski, Marcin; Baumann, Irith; Pfeifer, Dietmar; Kulinski, Michal; Rudelius, Martina; Lemeer, Simone; Kuster, Bernhard; Dierks, Christine; Peschel, Christian; Cabezas-Wallscheid, Nina; Duque-Afonso, Jesus; Zeiser, Robert; Cleary, Michael L; Schindler, Detlev; Schmitt-Graeff, Annette; Boerries, Melanie; Niemeyer, Charlotte M; Oostendorp, Robert Aj; Duyster, Justus; Illert, Anna Lena. Loss of the Fanconi anemia-associated protein NIPA causes bone marrow failure. The Journal Of Clinical Investigation. 2020;130(6):2827-2844.  PubMed
Kreutmair, Stefanie; Lippert, Lena Johanna; Klingeberg, Cathrin; Albers-Leischner, Corinna; Yacob, Salome; Shlyakhto, Valeria; Mueller, Tony; Mueller-Rudorf, Alina; Yu, Chuanjiang; Gorantla, Sivahari Prasad; Miething, Cornelius; Duyster, Justus; Illert, Anna Lena. NIPA (Nuclear Interaction Partner of ALK) Is Crucial for Effective NPM-ALK Mediated Lymphomagenesis. Frontiers In Oncology. 12( 35646639):875117.  PubMed