Anti ZBTB9 pAb (ATL-HPA058171)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058171-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZBTB9
Alternative Gene Name: MGC23166, ZNF919
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079605: 86%, ENSRNOG00000026799: 85%
Entrez Gene ID: 221504
Uniprot ID: Q96C00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQT |
Gene Sequence | DAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQT |
Gene ID - Mouse | ENSMUSG00000079605 |
Gene ID - Rat | ENSRNOG00000026799 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZBTB9 pAb (ATL-HPA058171) | |
Datasheet | Anti ZBTB9 pAb (ATL-HPA058171) Datasheet (External Link) |
Vendor Page | Anti ZBTB9 pAb (ATL-HPA058171) at Atlas Antibodies |
Documents & Links for Anti ZBTB9 pAb (ATL-HPA058171) | |
Datasheet | Anti ZBTB9 pAb (ATL-HPA058171) Datasheet (External Link) |
Vendor Page | Anti ZBTB9 pAb (ATL-HPA058171) |