Anti ZBTB9 pAb (ATL-HPA058171)

Atlas Antibodies

Catalog No.:
ATL-HPA058171-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger and BTB domain containing 9
Gene Name: ZBTB9
Alternative Gene Name: MGC23166, ZNF919
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079605: 86%, ENSRNOG00000026799: 85%
Entrez Gene ID: 221504
Uniprot ID: Q96C00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQT
Gene Sequence DAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQT
Gene ID - Mouse ENSMUSG00000079605
Gene ID - Rat ENSRNOG00000026799
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZBTB9 pAb (ATL-HPA058171)
Datasheet Anti ZBTB9 pAb (ATL-HPA058171) Datasheet (External Link)
Vendor Page Anti ZBTB9 pAb (ATL-HPA058171) at Atlas Antibodies

Documents & Links for Anti ZBTB9 pAb (ATL-HPA058171)
Datasheet Anti ZBTB9 pAb (ATL-HPA058171) Datasheet (External Link)
Vendor Page Anti ZBTB9 pAb (ATL-HPA058171)