Anti ZBTB9 pAb (ATL-HPA058171)

Atlas Antibodies

SKU: ATL-HPA058171-25

• 
• 

Protein Description: zinc finger and BTB domain containing 9
Gene Name: ZBTB9
Alternative Gene Name: MGC23166, ZNF919
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079605: 86%, ENSRNOG00000026799: 85%
Entrez Gene ID: 221504
Uniprot ID: Q96C00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQT
• Gene Sequence: DAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQT
• Gene ID - Mouse: ENSMUSG00000079605
• Gene ID - Rat: ENSRNOG00000026799
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.