Anti ZBTB6 pAb (ATL-HPA076894)

Atlas Antibodies

Catalog No.: ATL-HPA076894-25

Protein Description: zinc finger and BTB domain containing 6
Gene Name: ZBTB6
Alternative Gene Name: ZID, ZNF482
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066798: 88%, ENSRNOG00000009340: 86%
Entrez Gene ID: 10773
Uniprot ID: Q15916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGSYGTVSEIQNLEEGYSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQC
• Gene Sequence: EGSYGTVSEIQNLEEGYSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQC
• Gene ID - Mouse: ENSMUSG00000066798
• Gene ID - Rat: ENSRNOG00000009340
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.