Anti ZBTB6 pAb (ATL-HPA054111)

Atlas Antibodies

Catalog No.:
ATL-HPA054111-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger and BTB domain containing 6
Gene Name: ZBTB6
Alternative Gene Name: ZID, ZNF482
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066798: 92%, ENSRNOG00000009340: 89%
Entrez Gene ID: 10773
Uniprot ID: Q15916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CTEPLSKYLEIDLSMKNNNQHTDLCQSSDPDVKNEDENSDKDCEIIEISEDSPVNIDFHVK
Gene Sequence CTEPLSKYLEIDLSMKNNNQHTDLCQSSDPDVKNEDENSDKDCEIIEISEDSPVNIDFHVK
Gene ID - Mouse ENSMUSG00000066798
Gene ID - Rat ENSRNOG00000009340
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZBTB6 pAb (ATL-HPA054111)
Datasheet Anti ZBTB6 pAb (ATL-HPA054111) Datasheet (External Link)
Vendor Page Anti ZBTB6 pAb (ATL-HPA054111) at Atlas Antibodies

Documents & Links for Anti ZBTB6 pAb (ATL-HPA054111)
Datasheet Anti ZBTB6 pAb (ATL-HPA054111) Datasheet (External Link)
Vendor Page Anti ZBTB6 pAb (ATL-HPA054111)