Anti ZBTB49 pAb (ATL-HPA024450)

Atlas Antibodies

Catalog No.: ATL-HPA024450-25

Protein Description: zinc finger and BTB domain containing 49
Gene Name: ZBTB49
Alternative Gene Name: FLJ38559, ZNF509
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029127: 82%, ENSRNOG00000005633: 79%
Entrez Gene ID: 166793
Uniprot ID: Q6ZSB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFSQYFRSLFQNSSSQKNDVFHLDVKNVSGIGQILDFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCHTFLKSATVVQPPGMPCNSTLSLQSTLTPDATCVISENYP
• Gene Sequence: AFSQYFRSLFQNSSSQKNDVFHLDVKNVSGIGQILDFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCHTFLKSATVVQPPGMPCNSTLSLQSTLTPDATCVISENYP
• Gene ID - Mouse: ENSMUSG00000029127
• Gene ID - Rat: ENSRNOG00000005633
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.