Anti ZBTB4 pAb (ATL-HPA064763)

Atlas Antibodies

SKU: ATL-HPA064763-25

• 
• 

Protein Description: zinc finger and BTB domain containing 4
Gene Name: ZBTB4
Alternative Gene Name: KAISO-L1, KIAA1538, ZNF903
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018750: 88%, ENSRNOG00000014689: 86%
Entrez Gene ID: 57659
Uniprot ID: Q9P1Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEEASETASLQDPIISGGEEPPVVASGGSYVYPPV
• Gene Sequence: TPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEEASETASLQDPIISGGEEPPVVASGGSYVYPPV
• Gene ID - Mouse: ENSMUSG00000018750
• Gene ID - Rat: ENSRNOG00000014689
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.