Anti ZBTB4 pAb (ATL-HPA064763)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064763-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZBTB4
Alternative Gene Name: KAISO-L1, KIAA1538, ZNF903
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018750: 88%, ENSRNOG00000014689: 86%
Entrez Gene ID: 57659
Uniprot ID: Q9P1Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEEASETASLQDPIISGGEEPPVVASGGSYVYPPV |
Gene Sequence | TPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEEASETASLQDPIISGGEEPPVVASGGSYVYPPV |
Gene ID - Mouse | ENSMUSG00000018750 |
Gene ID - Rat | ENSRNOG00000014689 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZBTB4 pAb (ATL-HPA064763) | |
Datasheet | Anti ZBTB4 pAb (ATL-HPA064763) Datasheet (External Link) |
Vendor Page | Anti ZBTB4 pAb (ATL-HPA064763) at Atlas Antibodies |
Documents & Links for Anti ZBTB4 pAb (ATL-HPA064763) | |
Datasheet | Anti ZBTB4 pAb (ATL-HPA064763) Datasheet (External Link) |
Vendor Page | Anti ZBTB4 pAb (ATL-HPA064763) |