Anti ZBTB32 pAb (ATL-HPA076730 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA076730-25
  • Immunohistochemistry analysis in human testis and endometrium tissues using Anti-ZBTB32 antibody. Corresponding ZBTB32 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger and BTB domain containing 32
Gene Name: ZBTB32
Alternative Gene Name: FAXF, FAZF, Rog, TZFP, ZNF538
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006310: 82%, ENSRNOG00000042465: 82%
Entrez Gene ID: 27033
Uniprot ID: Q9Y2Y4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CPSLASMQAHMRGHSPSQLPPGWTIRSTFLYSSSRPSRPSTSPCCPSSSTT
Gene Sequence CPSLASMQAHMRGHSPSQLPPGWTIRSTFLYSSSRPSRPSTSPCCPSSSTT
Gene ID - Mouse ENSMUSG00000006310
Gene ID - Rat ENSRNOG00000042465
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ZBTB32 pAb (ATL-HPA076730 w/enhanced validation)
Datasheet Anti ZBTB32 pAb (ATL-HPA076730 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZBTB32 pAb (ATL-HPA076730 w/enhanced validation)