Anti ZBTB25 pAb (ATL-HPA054699)

Atlas Antibodies

Catalog No.:
ATL-HPA054699-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger and BTB domain containing 25
Gene Name: ZBTB25
Alternative Gene Name: C14orf51, KUP, ZNF46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056459: 84%, ENSRNOG00000006441: 86%
Entrez Gene ID: 7597
Uniprot ID: P24278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IGLDDGTADQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTFTENSVKIHLCHYCGERFDSRSNLR
Gene Sequence IGLDDGTADQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTFTENSVKIHLCHYCGERFDSRSNLR
Gene ID - Mouse ENSMUSG00000056459
Gene ID - Rat ENSRNOG00000006441
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZBTB25 pAb (ATL-HPA054699)
Datasheet Anti ZBTB25 pAb (ATL-HPA054699) Datasheet (External Link)
Vendor Page Anti ZBTB25 pAb (ATL-HPA054699) at Atlas Antibodies

Documents & Links for Anti ZBTB25 pAb (ATL-HPA054699)
Datasheet Anti ZBTB25 pAb (ATL-HPA054699) Datasheet (External Link)
Vendor Page Anti ZBTB25 pAb (ATL-HPA054699)