Anti ZBTB2 pAb (ATL-HPA023458)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023458-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ZBTB2
Alternative Gene Name: bA351K16.2, KIAA1483, ZNF437
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075327: 98%, ENSRNOG00000019544: 96%
Entrez Gene ID: 57621
Uniprot ID: Q8N680
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DTYTMVDKQTLELCTFEEGSQMDNMLVQTNKPYKCNLCDKTFSTPNEVVKHSCQNQNSDVFALDEGRSILLGSGDSEVTEPDHPVLASIK |
| Gene Sequence | DTYTMVDKQTLELCTFEEGSQMDNMLVQTNKPYKCNLCDKTFSTPNEVVKHSCQNQNSDVFALDEGRSILLGSGDSEVTEPDHPVLASIK |
| Gene ID - Mouse | ENSMUSG00000075327 |
| Gene ID - Rat | ENSRNOG00000019544 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZBTB2 pAb (ATL-HPA023458) | |
| Datasheet | Anti ZBTB2 pAb (ATL-HPA023458) Datasheet (External Link) |
| Vendor Page | Anti ZBTB2 pAb (ATL-HPA023458) at Atlas Antibodies |
| Documents & Links for Anti ZBTB2 pAb (ATL-HPA023458) | |
| Datasheet | Anti ZBTB2 pAb (ATL-HPA023458) Datasheet (External Link) |
| Vendor Page | Anti ZBTB2 pAb (ATL-HPA023458) |