Anti ZBTB2 pAb (ATL-HPA023458)

Atlas Antibodies

Catalog No.: ATL-HPA023458-25

Protein Description: zinc finger and BTB domain containing 2
Gene Name: ZBTB2
Alternative Gene Name: bA351K16.2, KIAA1483, ZNF437
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075327: 98%, ENSRNOG00000019544: 96%
Entrez Gene ID: 57621
Uniprot ID: Q8N680
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTYTMVDKQTLELCTFEEGSQMDNMLVQTNKPYKCNLCDKTFSTPNEVVKHSCQNQNSDVFALDEGRSILLGSGDSEVTEPDHPVLASIK
• Gene Sequence: DTYTMVDKQTLELCTFEEGSQMDNMLVQTNKPYKCNLCDKTFSTPNEVVKHSCQNQNSDVFALDEGRSILLGSGDSEVTEPDHPVLASIK
• Gene ID - Mouse: ENSMUSG00000075327
• Gene ID - Rat: ENSRNOG00000019544
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.