Anti ZBTB14 pAb (ATL-HPA050758)

Atlas Antibodies

Catalog No.:
ATL-HPA050758-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger and BTB domain containing 14
Gene Name: ZBTB14
Alternative Gene Name: ZFP161, ZNF478
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049672: 97%, ENSRNOG00000016719: 97%
Entrez Gene ID: 7541
Uniprot ID: O43829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSP
Gene Sequence LRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSP
Gene ID - Mouse ENSMUSG00000049672
Gene ID - Rat ENSRNOG00000016719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZBTB14 pAb (ATL-HPA050758)
Datasheet Anti ZBTB14 pAb (ATL-HPA050758) Datasheet (External Link)
Vendor Page Anti ZBTB14 pAb (ATL-HPA050758) at Atlas Antibodies

Documents & Links for Anti ZBTB14 pAb (ATL-HPA050758)
Datasheet Anti ZBTB14 pAb (ATL-HPA050758) Datasheet (External Link)
Vendor Page Anti ZBTB14 pAb (ATL-HPA050758)