Anti ZBTB10 pAb (ATL-HPA050569)

Atlas Antibodies

Catalog No.:
ATL-HPA050569-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger and BTB domain containing 10
Gene Name: ZBTB10
Alternative Gene Name: FLJ12752, RINZF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069114: 93%, ENSRNOG00000061862: 94%
Entrez Gene ID: 65986
Uniprot ID: Q96DT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGEGETVQHFPLARPKSLMQKLQCSFQTSWLKDFPWLRYSKDTGLMSCGWCQKTPADGGSVDLPPVGHDELSRGTRNYKKTLLLRHHVSTEHKLHEAN
Gene Sequence AGEGETVQHFPLARPKSLMQKLQCSFQTSWLKDFPWLRYSKDTGLMSCGWCQKTPADGGSVDLPPVGHDELSRGTRNYKKTLLLRHHVSTEHKLHEAN
Gene ID - Mouse ENSMUSG00000069114
Gene ID - Rat ENSRNOG00000061862
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZBTB10 pAb (ATL-HPA050569)
Datasheet Anti ZBTB10 pAb (ATL-HPA050569) Datasheet (External Link)
Vendor Page Anti ZBTB10 pAb (ATL-HPA050569) at Atlas Antibodies

Documents & Links for Anti ZBTB10 pAb (ATL-HPA050569)
Datasheet Anti ZBTB10 pAb (ATL-HPA050569) Datasheet (External Link)
Vendor Page Anti ZBTB10 pAb (ATL-HPA050569)