Anti ZBED8 pAb (ATL-HPA055817)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055817-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZBED8
Alternative Gene Name: Buster3, C5orf54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034173: 45%, ENSRNOG00000000918: 48%
Entrez Gene ID: 63920
Uniprot ID: Q8IZ13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILQQVLEDIKASPLKVGIQLAETTDMDDCSQLMAFVRYIKEREIVEEFLFCEPLQLSMKGIDVFNLFRDFFLKHKIALDVCGSVCTDGASSMLGENSEFV |
| Gene Sequence | ILQQVLEDIKASPLKVGIQLAETTDMDDCSQLMAFVRYIKEREIVEEFLFCEPLQLSMKGIDVFNLFRDFFLKHKIALDVCGSVCTDGASSMLGENSEFV |
| Gene ID - Mouse | ENSMUSG00000034173 |
| Gene ID - Rat | ENSRNOG00000000918 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZBED8 pAb (ATL-HPA055817) | |
| Datasheet | Anti ZBED8 pAb (ATL-HPA055817) Datasheet (External Link) |
| Vendor Page | Anti ZBED8 pAb (ATL-HPA055817) at Atlas Antibodies |
| Documents & Links for Anti ZBED8 pAb (ATL-HPA055817) | |
| Datasheet | Anti ZBED8 pAb (ATL-HPA055817) Datasheet (External Link) |
| Vendor Page | Anti ZBED8 pAb (ATL-HPA055817) |