Anti ZBED6CL pAb (ATL-HPA019724 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019724-25

Protein Description: ZBED6 C-terminal like
Gene Name: ZBED6CL
Alternative Gene Name: C7orf29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029059: 29%, ENSRNOG00000009448: 30%
Entrez Gene ID: 113763
Uniprot ID: Q96FA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKIEAILPWGPTDIDHWKQVLVYKVKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSHSG
• Gene Sequence: GKIEAILPWGPTDIDHWKQVLVYKVKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSHSG
• Gene ID - Mouse: ENSMUSG00000029059
• Gene ID - Rat: ENSRNOG00000009448
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.