Anti ZBED6 pAb (ATL-HPA026439)

Atlas Antibodies

Catalog No.: ATL-HPA026439-25

Protein Description: zinc finger BED-type containing 6
Gene Name: ZBED6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102976: 62%, ENSRNOG00000053210: 65%
Entrez Gene ID: 100381270
Uniprot ID: O75152
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLSTKQGEEPLVRLSLTERLGKRKFSAGGDSDPPLKRSLAQRLGKKVEAPETNIDKTPKKAQVSKSLKERLGMSADPDNEDATDKVNKVGEIHVK
• Gene Sequence: TLSTKQGEEPLVRLSLTERLGKRKFSAGGDSDPPLKRSLAQRLGKKVEAPETNIDKTPKKAQVSKSLKERLGMSADPDNEDATDKVNKVGEIHVK
• Gene ID - Mouse: ENSMUSG00000102976
• Gene ID - Rat: ENSRNOG00000053210
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZBED6 pAb (ATL-HPA026439) – 1 Found

Zhu, Shenglong; Zhang, Jingwei; Jiang, Xuan; Wang, Wei; Chen, Yong Q. Free fatty acid receptor 4 deletion attenuates colitis by modulating Treg Cells via ZBED6-IL33 pathway. Ebiomedicine. 2022;80( 35588628):104060.